HORDB

ID: hor006283
Uniprot ID: Q62923
Protein name: Neuropeptide 1
Gene name: Pnoc
Organism: Rattus norvegicus (Rat)
Family: Opioid neuropeptide precursor family
Source: Animal
Expression: Expressed predominantly in the spinal cord and brain, being more abundant in the hypothalamus and striatum. Also found in small amounts in ovary.
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001515 opioid peptide activity; GO:0031628 opioid receptor binding; GO:0048018 receptor ligand activity
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007270 neuron-neuron synaptic transmission; GO:0007565 female pregnancy; GO:0007600 sensory perception; GO:0019233 sensory perception of pain
GO CC: GO:0005576 extracellular region; GO:0005886 plasma membrane; GO:0030425 dendrite; GO:0043025 neuronal cell body; GO:0043679 axon terminus; GO:0045202 synapse; GO:0097060 synaptic membrane

Sequence: MPRVRSVVQARDAEPEADAEPVADEADEVEQKQLQ
Length: 35(98-132)
Propeptide: MKILFCDVLLLSLLSSVFSSCPEDCLTCQERLHPAPGSFNLKLCILQCEEKVFPRPLWTLCTKAMASDSEQLSPADPELTSAALYQSKASEMQHLKRMPRVRSVVQARDAEPEADAEPVADEADEVEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
Signal peptide: MKILFCDVLLLSLLSSVFS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: [Nociceptin]: Ligand of the opioid receptor-like receptor OPRL1. It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development.
Mechanism: NA
Cross BBB: NA
Target: Oprl1
Target Unid: P35370
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006283_AF2.pdb

hor006283_ESM.pdb

Mass:	451389	Formula:	C162H265N49O61S
Absent amino acids:	CFGHINTWY	Common amino acids:	AE
pI:	3.9	Basic residues:	4
Polar residues:	1	Hydrophobic residues:	12
Hydrophobicity:	-98.57	Boman Index:	-11328
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	69.71
Instability Index:	6844.86	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 8710930
Title: Primary structure and tissue distribution of the orphanin FQ precursor.
PubMed ID: 8710928
Title: Structure, tissue distribution, and chromosomal localization of the prepronociceptin gene.
PubMed ID: 7566152
Title: Isolation and structure of the endogenous agonist of opioid receptor-like ORL1 receptor.